MKNK2 Antibody - N-terminal region : FITC

MKNK2 Antibody - N-terminal region : FITC
SKU
AVIARP55352_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MKNK2

Key Reference: Wang,P., (2006) Sci. China, C, Life Sci. 49 (3), 265-273

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP kinase-interacting serine/threonine-protein kinase 2

Protein Size: 465

Purification: Affinity Purified
More Information
SKU AVIARP55352_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55352_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2872
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×