MMD2 Antibody - N-terminal region : FITC

MMD2 Antibody - N-terminal region : FITC
SKU
AVIARP54545_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMD2

Key Reference: Tang,Y.T., (2005) J. Mol. Evol. 61 (3), 372-380

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Monocyte to macrophage differentiation factor 2

Protein Size: 270

Purification: Affinity Purified
More Information
SKU AVIARP54545_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54545_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221938
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×