MMP13 Antibody - middle region : FITC

MMP13 Antibody - middle region : FITC
SKU
AVIARP56350_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMP13

Key Reference: Borghese,B., (2008) Hum. Reprod. 23 (5), 1207-1213

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Collagenase 3

Protein Size: 471

Purification: Affinity Purified
More Information
SKU AVIARP56350_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56350_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4322
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×