MMP26 Antibody - C-terminal region : Biotin

MMP26 Antibody - C-terminal region : Biotin
SKU
AVIARP57558_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MMP26

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Matrix metalloproteinase-26

Protein Size: 261

Purification: Affinity Purified
More Information
SKU AVIARP57558_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57558_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56547
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×