MMP8 antibody

MMP8 antibody
SKU
GTX03673-100
Packaging Unit
100 μg
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Application Note: WB: 0.1-0.5μg/ml. IHC-P: 0.5-1μg/m. ELISA: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 53

Form: Liquid

Buffer (with preservative): 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 5mg BSA, 0.05mg sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades types I, II and III collagens. Mice lacking the encoded protein exhibit abnormalities in the inflammatory responses to various agents. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. [provided by RefSeq, Feb 2016]

Uniprot ID: O70138

Antigen Species: Mouse

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: matrix metallopeptidase 8
More Information
SKU GTX03673-100
Manufacturer GeneTex
Manufacturer SKU GTX03673-100
Package Unit 100 μg
Quantity Unit STK
Reactivity Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Immunohistochemistry (paraffin), Western Blotting, ELISA
Isotype IgG
Human Gene ID 17394
Host Rabbit
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF)
×