MNS1 Antibody - middle region : FITC

MNS1 Antibody - middle region : FITC
SKU
AVIARP57224_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuc

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MNS1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Meiosis-specific nuclear structural protein 1

Protein Size: 495

Purification: Affinity Purified
More Information
SKU AVIARP57224_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57224_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55329
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×