MOS Antibody - middle region : FITC

MOS Antibody - middle region : FITC
SKU
AVIARP56631_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MOS

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proto-oncogene serine/threonine-protein kinase mos

Protein Size: 346

Purification: Affinity Purified
More Information
SKU AVIARP56631_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56631_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4342
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×