MOS Antibody - middle region : HRP

MOS Antibody - middle region : HRP
SKU
AVIARP56631_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MOS

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proto-oncogene serine/threonine-protein kinase mos

Protein Size: 346

Purification: Affinity Purified
More Information
SKU AVIARP56631_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56631_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4342
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×