Mpc1 Antibody - N-terminal region : HRP

Mpc1 Antibody - N-terminal region : HRP
SKU
AVIARP56834_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mpc1 may be involved in apoptosis of neuronal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Mpc1

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial pyruvate carrier 1

Protein Size: 109

Purification: Affinity Purified
More Information
SKU AVIARP56834_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56834_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Yeast
Clonality Polyclonal
Application Western Blotting
Human Gene ID 171087
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×