MPEG1 Antibody - C-terminal region : Biotin

MPEG1 Antibody - C-terminal region : Biotin
SKU
AVIARP54495_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MPEG1

Key Reference: Spilsbury,K., (1995) Blood 85 (6), 1620-1629

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Macrophage-expressed gene 1 protein

Protein Size: 716

Purification: Affinity Purified
More Information
SKU AVIARP54495_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54495_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219972
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×