Mpp2 Antibody - C-terminal region : FITC

Mpp2 Antibody - C-terminal region : FITC
SKU
AVIARP56633_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mpp2 is a protein related to CASK that may play a role in synaptic vesicle exocytosis and synaptic junctions.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Mpp2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2), isoform CRA_a EMBL EDM06167.1

Protein Size: 552

Purification: Affinity Purified
More Information
SKU AVIARP56633_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56633_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 85275
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×