MPP3 Antibody - middle region : HRP

MPP3 Antibody - middle region : HRP
SKU
AVIARP56335_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPP3

Key Reference: Kantardzhieva,A., (2006) FEBS J. 273 (6), 1152-1165

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: GVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAGUK p55 subfamily member 3

Protein Size: 585

Purification: Affinity Purified
More Information
SKU AVIARP56335_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56335_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4356
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×