MPP3 Antibody - N-terminal region : Biotin

MPP3 Antibody - N-terminal region : Biotin
SKU
AVIARP56334_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MPP3

Key Reference: Kantardzhieva,A., (2006) FEBS J. 273 (6), 1152-1165

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAGUK p55 subfamily member 3

Protein Size: 585

Purification: Affinity Purified
More Information
SKU AVIARP56334_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56334_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4356
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×