Mprip Antibody - middle region : Biotin

Mprip Antibody - middle region : Biotin
SKU
AVIARP57861_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mouse homolog binds F-actin and may play a role in F-actin bundling and cytoskeleton organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mprip

Molecular Weight: 113kDa

Peptide Sequence: Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin phosphatase Rho-interacting protein

Protein Size: 1029

Purification: Affinity Purified
More Information
SKU AVIARP57861_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57861_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 116504
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×