MRPL48 Antibody - middle region : FITC

MRPL48 Antibody - middle region : FITC
SKU
AVIARP56816_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPL48

Key Reference: Zhang,Z. (2003) Genomics 81 (5), 468-480

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 39S ribosomal protein L48, mitochondrial

Protein Size: 212

Purification: Affinity Purified
More Information
SKU AVIARP56816_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56816_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51642
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×