MRPL50 Antibody - N-terminal region : Biotin

MRPL50 Antibody - N-terminal region : Biotin
SKU
AVIARP57317_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RM50

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: CREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 39S ribosomal protein L50, mitochondrial

Protein Size: 158

Purification: Affinity Purified
More Information
SKU AVIARP57317_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57317_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54534
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×