MRPS2 Antibody - middle region : Biotin

MRPS2 Antibody - middle region : Biotin
SKU
AVIARP56813_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPS2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 28S ribosomal protein S2, mitochondrial

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP56813_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56813_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51116
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×