MTBP Antibody - middle region : Biotin

MTBP Antibody - middle region : Biotin
SKU
AVIARP55384_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein that interacts with the oncoprotein mouse double minute 2. The encoded protein regulates progression through the cell cycle and may be involved in tumor formation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTBP

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mdm2-binding protein

Protein Size: 329

Purification: Affinity Purified
More Information
SKU AVIARP55384_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55384_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27085
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×