MTCH2 Antibody - N-terminal region : Biotin

MTCH2 Antibody - N-terminal region : Biotin
SKU
AVIARP55027_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2

Key Reference: Grinberg,M., (2005) Mol. Cell. Biol. 25 (11), 4579-4590

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial carrier homolog 2

Protein Size: 303

Purification: Affinity Purified
More Information
SKU AVIARP55027_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55027_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23788
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×