MTCH2 Antibody - N-terminal region : HRP

MTCH2 Antibody - N-terminal region : HRP
SKU
AVIARP55027_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2

Key Reference: Grinberg,M., (2005) Mol. Cell. Biol. 25 (11), 4579-4590

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial carrier homolog 2

Protein Size: 303

Purification: Affinity Purified
More Information
SKU AVIARP55027_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55027_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23788
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×