MTIF3 Antibody - middle region : HRP

MTIF3 Antibody - middle region : HRP
SKU
AVIARP55563_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTIF3

Key Reference: Abahuni,N., (2007) Neurosci. Lett. 414 (2), 126-129

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: AVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Translation initiation factor IF-3, mitochondrial

Protein Size: 278

Purification: Affinity Purified
More Information
SKU AVIARP55563_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55563_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219402
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×