MTMR12 Antibody - middle region : Biotin

MTMR12 Antibody - middle region : Biotin
SKU
AVIARP56274_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes. The protein encoded by this gene functions as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTMR12

Key Reference: Nandurkar,H.H., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (15), 8660-8665

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myotubularin-related protein 12

Protein Size: 747

Purification: Affinity Purified
More Information
SKU AVIARP56274_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56274_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54545
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×