MTO1 Antibody - N-terminal region : FITC

MTO1 Antibody - N-terminal region : FITC
SKU
AVIARP54841_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTO1

Key Reference: Krull,M., (2005) Mol. Biol. Evol. 22 (8), 1702-1711

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein MTO1 homolog, mitochondrial

Protein Size: 732

Purification: Affinity Purified
More Information
SKU AVIARP54841_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54841_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25821
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×