MTRF1L Antibody - N-terminal region : FITC

MTRF1L Antibody - N-terminal region : FITC
SKU
AVIARP56319_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene plays a role in mitochondrial translation termination, and is thought to be a release factor that is involved in the dissociation of the complete protein from the final tRNA, the ribosome, and the cognate mRNA. This protein acts upon UAA and UAG stop codons, but has no in vitro activity against UGA, which encodes tryptophan in human mitochondrion, or, the mitochondrial non-cognate stop codons, AGA and AGG. This protein shares sequence similarity to bacterial release factors. Pseudogenes of this gene are found on chromosomes 4, 8, and 11. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RF1ML

Key Reference: Nozaki,Y., (2008) Genes Cells 13 (5), 429-438

Molecular Weight: 29 kDa

Peptide Sequence: Synthetic peptide located within the following region: MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: peptide chain release factor 1-like, mitochondrial

Protein Size: 271

Purification: Affinity purified
More Information
SKU AVIARP56319_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56319_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54516
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×