MTRF1L Antibody - N-terminal region : FITC

MTRF1L Antibody - N-terminal region : FITC
SKU
AVIARP56320_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTRF1L

Key Reference: Nozaki,Y., (2008) Genes Cells 13 (5), 429-438

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptide chain release factor 1-like, mitochondrial

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP56320_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56320_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54516
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×