MYBPH Antibody - middle region : Biotin

MYBPH Antibody - middle region : Biotin
SKU
AVIARP56599_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYBPH

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin-binding protein H

Protein Size: 477

Purification: Affinity Purified
More Information
SKU AVIARP56599_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56599_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4608
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×