MYD88 Antibody - middle region : HRP

MYD88 Antibody - middle region : HRP
SKU
AVIARP56353_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYD88

Key Reference: Dhiman,N., (2008) Vaccine 26 (14), 1731-1736

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Myeloid differentiation primary response protein MyD88

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP56353_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56353_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4615
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×