MYD88 Antibody - N-terminal region : FITC

MYD88 Antibody - N-terminal region : FITC
SKU
AVIARP56352_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYD88

Key Reference: Dhiman,N., (2008) Vaccine 26 (14), 1731-1736

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myeloid differentiation primary response protein MyD88

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP56352_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56352_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4615
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×