MYL4 Antibody - N-terminal region : FITC

MYL4 Antibody - N-terminal region : FITC
SKU
AVIARP56153_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin light chain 4

Protein Size: 197

Purification: Affinity Purified
More Information
SKU AVIARP56153_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56153_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4635
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×