MYL6 Antibody - N-terminal region : FITC

MYL6 Antibody - N-terminal region : FITC
SKU
AVIARP57711_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL6

Key Reference: Fu,Z.Y., (2006) Acta Biochim. Biophys. Sin. (Shanghai) 38 (9), 625-632

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin light polypeptide 6

Protein Size: 151

Purification: Affinity Purified
More Information
SKU AVIARP57711_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57711_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 4637
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×