Nap1l2 Antibody - N-terminal region : Biotin

Nap1l2 Antibody - N-terminal region : Biotin
SKU
AVIARP57573_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Nap1l2 is a acidic protein which may be involved in interactions with other proteins or DNA.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Nap1l2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleosome assembly protein 1-like 2

Protein Size: 460

Purification: Affinity Purified
More Information
SKU AVIARP57573_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57573_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 17954
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×