Nap1l5 Antibody - middle region : Biotin

Nap1l5 Antibody - middle region : Biotin
SKU
AVIARP55609_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GDSAAAPAAEEPQAPAENAPKPKKDFMESLPNSVKCRVLALKKLQKRCDK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleosome assembly protein 1-like 5

Protein Size: 156

Purification: Affinity Purified
More Information
SKU AVIARP55609_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55609_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58243
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×