NAPE-PLD Antibody - N-terminal region : FITC

NAPE-PLD Antibody - N-terminal region : FITC
SKU
AVIARP55927_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAPE-PLD

Key Reference: Egertova,M., (2008) J. Comp. Neurol. 506 (4), 604-615

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Protein Size: 393

Purification: Affinity Purified
More Information
SKU AVIARP55927_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55927_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222236
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×