NAPE-PLD Antibody - N-terminal region : HRP

NAPE-PLD Antibody - N-terminal region : HRP
SKU
AVIARP55927_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAPE-PLD

Key Reference: Egertova,M., (2008) J. Comp. Neurol. 506 (4), 604-615

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Protein Size: 393

Purification: Affinity Purified
More Information
SKU AVIARP55927_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55927_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222236
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×