NAPEPLD Antibody - C-terminal region : FITC

NAPEPLD Antibody - C-terminal region : FITC
SKU
AVIARP55928_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008]

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NAPEPLD

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: AFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Protein Size: 466

Purification: Affinity Purified
More Information
SKU AVIARP55928_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55928_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222236
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×