NCAPH2 Antibody - N-terminal region : Biotin

NCAPH2 Antibody - N-terminal region : Biotin
SKU
AVIARP55483_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2

Key Reference: Ono,T., (2003) Cell 115 (1), 109-121

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Condensin-2 complex subunit H2

Protein Size: 605

Purification: Affinity Purified

Subunit: H2
More Information
SKU AVIARP55483_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55483_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29781
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×