NCDN Antibody - N-terminal region : Biotin

NCDN Antibody - N-terminal region : Biotin
SKU
AVIARP54995_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCDN

Key Reference: Qiu,C., (2008) J. Biol. Chem. 283 (5), 2734-2740

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neurochondrin

Protein Size: 729

Purification: Affinity Purified
More Information
SKU AVIARP54995_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54995_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23154
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×