NDN Antibody - middle region : FITC

NDN Antibody - middle region : FITC
SKU
AVIARP56358_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDN

Key Reference: Zanella,S., (2008) J. Neurosci. 28 (7), 1745-1755

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Necdin

Protein Size: 321

Purification: Affinity Purified
More Information
SKU AVIARP56358_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56358_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4692
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×