NDN Antibody - middle region : HRP

NDN Antibody - middle region : HRP
SKU
AVIARP56358_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDN

Key Reference: Zanella,S., (2008) J. Neurosci. 28 (7), 1745-1755

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Necdin

Protein Size: 321

Purification: Affinity Purified
More Information
SKU AVIARP56358_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56358_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4692
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×