NDUFA9 Antibody - N-terminal region : HRP

NDUFA9 Antibody - N-terminal region : HRP
SKU
AVIARP56604_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NDUFA9

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

Protein Size: 377

Purification: Affinity Purified

Subunit: 9, mitochondrial
More Information
SKU AVIARP56604_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56604_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4704
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×