NDUFC1 Antibody - middle region : Biotin

NDUFC1 Antibody - middle region : Biotin
SKU
AVIARP56360_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The imme

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFC1

Key Reference: Loeffen,J.L., (1998) Biochem. Biophys. Res. Commun. 253 (2), 415-422

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

Protein Size: 76

Purification: Affinity Purified

Subunit: C1, mitochondrial
More Information
SKU AVIARP56360_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56360_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4717
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×