NDUFC1 Antibody - middle region : HRP

NDUFC1 Antibody - middle region : HRP
SKU
AVIARP56360_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The imme

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFC1

Key Reference: Loeffen,J.L., (1998) Biochem. Biophys. Res. Commun. 253 (2), 415-422

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

Protein Size: 76

Purification: Affinity Purified

Subunit: C1, mitochondrial
More Information
SKU AVIARP56360_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56360_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4717
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×