NDUFS3 Antibody - middle region : FITC

NDUFS3 Antibody - middle region : FITC
SKU
AVIARP56579_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Key Reference: Vogel,R.O., (2007) J. Biol. Chem. 282 (10), 7582-7590

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

Protein Size: 264

Purification: Affinity Purified
More Information
SKU AVIARP56579_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56579_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4722
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×