NECAB1 Antibody - N-terminal region : Biotin

NECAB1 Antibody - N-terminal region : Biotin
SKU
AVIARP57627_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NECA1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: DSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-terminal EF-hand calcium-binding protein 1

Protein Size: 351

Purification: Affinity Purified
More Information
SKU AVIARP57627_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57627_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64168
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×