NEGR1 Antibody - N-terminal region : Biotin

NEGR1 Antibody - N-terminal region : Biotin
SKU
AVIARP55701_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NEGR1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuronal growth regulator 1

Protein Size: 354

Purification: Affinity Purified
More Information
SKU AVIARP55701_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55701_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 257194
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×