Nfkbiz Antibody - C-terminal region : FITC

Nfkbiz Antibody - C-terminal region : FITC
SKU
AVIARP57676_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NF-kappa-B inhibitor zeta

Protein Size: 728

Purification: Affinity Purified
More Information
SKU AVIARP57676_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57676_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 80859
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×