NHLH1 Antibody - middle region : Biotin

NHLH1 Antibody - middle region : Biotin
SKU
AVIARP57876_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NHLH1 may serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NHLH1

Key Reference: Manetopoulos,C., (2003) Biochem. Biophys. Res. Commun. 307 (4), 891-899

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: AKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Helix-loop-helix protein 1

Protein Size: 133

Purification: Affinity Purified
More Information
SKU AVIARP57876_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57876_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4807
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×