NKIRAS2 Antibody - C-terminal region : HRP

NKIRAS2 Antibody - C-terminal region : HRP
SKU
AVIARP54370_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NKIRAS2

Key Reference: Fenwick,C., (er) Ann. Rheum. Dis. (2008) In press

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 2

Protein Size: 191

Purification: Affinity Purified
More Information
SKU AVIARP54370_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54370_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 28511
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×