NLK Antibody - middle region : Biotin

NLK Antibody - middle region : Biotin
SKU
AVIARP56863_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NLK

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase NLK

Protein Size: 527

Purification: Affinity Purified
More Information
SKU AVIARP56863_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56863_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51701
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×