NLRP1 Antibody - N-terminal region : FITC

NLRP1 Antibody - N-terminal region : FITC
SKU
AVIARP54478_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1

Key Reference: Fahy,R.J., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 983-988

Molecular Weight: 155kDa

Peptide Sequence: Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NACHT, LRR and PYD domains-containing protein 1

Protein Size: 1375

Purification: Affinity Purified
More Information
SKU AVIARP54478_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54478_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22861
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×